Lineage for d4iefb2 (4ief B:580-661)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1299386Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1300237Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 1300238Protein automated matches [190226] (22 species)
    not a true protein
  7. 1300339Species Porphyromonas gingivalis [TaxId:242619] [226635] (1 PDB entry)
  8. 1300340Domain d4iefb2: 4ief B:580-661 [223141]
    Other proteins in same PDB: d4iefb1, d4iefd1, d4ieff1, d4iefh1
    automated match to d1cvra1
    complexed with ba, ca, cl, gol, mg, na, trs

Details for d4iefb2

PDB Entry: 4ief (more details), 2.3 Å

PDB Description: complex of porphyromonas gingivalis rgpb pro- and mature domains
PDB Compounds: (B:) Gingipain R2 Mature Domain

SCOPe Domain Sequences for d4iefb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iefb2 b.1.18.0 (B:580-661) automated matches {Porphyromonas gingivalis [TaxId: 242619]}
ptkmqvtapanisasaqtfevacdyngaiatlsddgdmvgtaivkdgkaiiklnesiade
tnltltvvgynkvtvikdvkve

SCOPe Domain Coordinates for d4iefb2:

Click to download the PDB-style file with coordinates for d4iefb2.
(The format of our PDB-style files is described here.)

Timeline for d4iefb2: