Lineage for d4id5a1 (4id5 A:1-429)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246832Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2246833Superfamily e.8.1: DNA/RNA polymerases [56672] (7 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2247182Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)
  6. 2247598Protein automated matches [190211] (6 species)
    not a true protein
  7. 2247659Species Human immunodeficiency virus type 1 [TaxId:11678] [226272] (13 PDB entries)
  8. 2247668Domain d4id5a1: 4id5 A:1-429 [223125]
    Other proteins in same PDB: d4id5a2, d4id5a3
    automated match to d1bqna2
    protein/DNA complex; protein/RNA complex; complexed with 1ff, dms, mg, t27

Details for d4id5a1

PDB Entry: 4id5 (more details), 1.95 Å

PDB Description: hiv-1 reverse transcriptase with bound fragment at the rnase h primer grip site
PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d4id5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4id5a1 e.8.1.2 (A:1-429) automated matches {Human immunodeficiency virus type 1 [TaxId: 11678]}
pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpl
dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfaaqnpdivi
yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkalteviplteeae
lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
plvklwyql

SCOPe Domain Coordinates for d4id5a1:

Click to download the PDB-style file with coordinates for d4id5a1.
(The format of our PDB-style files is described here.)

Timeline for d4id5a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d4id5b_