Lineage for d4ibod_ (4ibo D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2845874Species Agrobacterium fabrum [TaxId:176299] [226548] (2 PDB entries)
  8. 2845878Domain d4ibod_: 4ibo D: [223097]
    automated match to d2rhcb_
    complexed with cl, mg

Details for d4ibod_

PDB Entry: 4ibo (more details), 2.1 Å

PDB Description: Crystal structure of a putative gluconate dehydrogenase from agrobacterium tumefaciens (target EFI-506446)
PDB Compounds: (D:) Gluconate dehydrogenase

SCOPe Domain Sequences for d4ibod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ibod_ c.2.1.0 (D:) automated matches {Agrobacterium fabrum [TaxId: 176299]}
msnqiifdlggrtalvtgssrglgramaeglavagarilingtdpsrvaqtvqefrnvgh
daeavafdvtseseiieafarldeqgidvdilvnnagiqfrkpmieletadwqrvidtnl
tsafmigreaakrmiprgygkivnigsltselaratvapytvakggikmltramaaewaq
ygiqanaigpgymltdmnqalidnpefdawvkartpakrwgkpqelvgtavflsasasdy
vngqiiyvdggmlsvl

SCOPe Domain Coordinates for d4ibod_:

Click to download the PDB-style file with coordinates for d4ibod_.
(The format of our PDB-style files is described here.)

Timeline for d4ibod_: