Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries) |
Domain d4i9wd1: 4i9w D:1-106 [223082] Other proteins in same PDB: d4i9wd2, d4i9wf2 automated match to d1eo8l1 complexed with ca, k |
PDB Entry: 4i9w (more details), 2.75 Å
SCOPe Domain Sequences for d4i9wd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i9wd1 b.1.1.0 (D:1-106) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qivltqspaimsaspgekvtmtcsasssvsymhwyqqksgtspkrwiydtsklasgvpar fsgsgsgtsysltissmeaedaatyycqqwsnspptfgagaklelk
Timeline for d4i9wd1: