SCOPe 2.04: Domain d4i9uf2: 4i9u F:160-331

Lineage for d4i9uf2 (4i9u F:160-331)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein automated matches [226882] (8 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225719] (5 PDB entries)

8. Domain d4i9uf2: 4i9u F:160-331 [223077]
   Other proteins in same PDB: d4i9ua1, d4i9ub1, d4i9uc1, d4i9ud1, d4i9ue1, d4i9uf1, d4i9ug1, d4i9uh1
   automated match to d9ldta2
   complexed with 1e7

Details for d4i9uf2

PDB Entry: 4i9u, 2.5 Å

PDB Description: Crystal structure of rabbit LDHA in complex with a fragment inhibitor AP26256

PDB Compounds: (F:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4i9uf2:

Sequence; same for both SEQRES and ATOM records:

>d4i9uf2 d.162.1.1 (F:160-331) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
sgcnldsarfrylmgerlgvhalschgwilgehgdssvpvwsgmnvagvslktlhpelgt
dadkeqwkqvhkqvvdsayeviklkgyttwaiglsvadlaesimknlrrvhpistmlkgl
ygikedvflsvpcvlgqngisdvvkvtltseeeahlkksadtlwgiqkelqf

Timeline for d4i9uf2:

• d4i9uf2 first appeared in SCOPe 2.03
  
• d4i9uf2 appears in SCOPe 2.05
  
• d4i9uf2 appears in the current release, SCOPe 2.08