Lineage for d4i9ue2 (4i9u E:160-331)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2556797Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2557171Protein automated matches [226882] (9 species)
    not a true protein
  7. 2557294Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225719] (6 PDB entries)
  8. 2557335Domain d4i9ue2: 4i9u E:160-331 [223075]
    Other proteins in same PDB: d4i9ua1, d4i9ub1, d4i9uc1, d4i9ud1, d4i9ue1, d4i9uf1, d4i9ug1, d4i9uh1
    automated match to d9ldta2
    complexed with 1e7

Details for d4i9ue2

PDB Entry: 4i9u (more details), 2.5 Å

PDB Description: Crystal structure of rabbit LDHA in complex with a fragment inhibitor AP26256
PDB Compounds: (E:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4i9ue2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i9ue2 d.162.1.1 (E:160-331) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
sgcnldsarfrylmgerlgvhalschgwilgehgdssvpvwsgmnvagvslktlhpelgt
dadkeqwkqvhkqvvdsayeviklkgyttwaiglsvadlaesimknlrrvhpistmlkgl
ygikedvflsvpcvlgqngisdvvkvtltseeeahlkksadtlwgiqkelqf

SCOPe Domain Coordinates for d4i9ue2:

Click to download the PDB-style file with coordinates for d4i9ue2.
(The format of our PDB-style files is described here.)

Timeline for d4i9ue2: