Lineage for d4i9hd2 (4i9h D:160-331)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2232530Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2232895Protein automated matches [226882] (7 species)
    not a true protein
  7. 2233018Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225719] (8 PDB entries)
  8. 2233026Domain d4i9hd2: 4i9h D:160-331 [223041]
    Other proteins in same PDB: d4i9ha1, d4i9hb1, d4i9hc1, d4i9hd1, d4i9he1, d4i9hf1, d4i9hg1, d4i9hh1
    automated match to d9ldta2
    complexed with 1e4

Details for d4i9hd2

PDB Entry: 4i9h (more details), 2.17 Å

PDB Description: Crystal structure of rabbit LDHA in complex with AP28669
PDB Compounds: (D:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4i9hd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i9hd2 d.162.1.1 (D:160-331) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
sgcnldsarfrylmgerlgvhalschgwilgehgdssvpvwsgmnvagvslktlhpelgt
dadkeqwkqvhkqvvdsayeviklkgyttwaiglsvadlaesimknlrrvhpistmlkgl
ygikedvflsvpcvlgqngisdvvkvtltseeeahlkksadtlwgiqkelqf

SCOPe Domain Coordinates for d4i9hd2:

Click to download the PDB-style file with coordinates for d4i9hd2.
(The format of our PDB-style files is described here.)

Timeline for d4i9hd2: