SCOPe 2.05: Domain d4i9hb1: 4i9h B:1-159

Lineage for d4i9hb1 (4i9h B:1-159)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein automated matches [226881] (5 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225718] (5 PDB entries)

8. Domain d4i9hb1: 4i9h B:1-159 [223036]
   Other proteins in same PDB: d4i9ha2, d4i9hb2, d4i9hc2, d4i9hd2, d4i9he2, d4i9hf2, d4i9hg2, d4i9hh2
   automated match to d9ldta1
   complexed with 1e4

Details for d4i9hb1

PDB Entry: 4i9h, 2.17 Å

PDB Description: Crystal structure of rabbit LDHA in complex with AP28669

PDB Compounds: (B:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4i9hb1:

Sequence, based on SEQRES records:

>d4i9hb1 c.2.1.5 (B:1-159) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkysphckllvvsnpvdiltyvawkisgfpknrvig

Sequence, based on observed residues (ATOM records):

>d4i9hb1 c.2.1.5 (B:1-159) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
mmdlqhgslflrtpkivsgkdysvtansklviitagarqsrlnlvqrnvnifkfiipnvv
kysphckllvvsnpvdiltyvawkisgfpknrvig

Timeline for d4i9hb1:

• d4i9hb1 first appeared in SCOPe 2.03
  
• d4i9hb1 appears in SCOPe 2.04
  
• d4i9hb1 appears in SCOPe 2.06
  
• d4i9hb1 appears in the current release, SCOPe 2.08