SCOPe 2.04: Domain d4i8xg1: 4i8x G:1-159

Lineage for d4i8xg1 (4i8x G:1-159)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein automated matches [226881] (6 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225718] (5 PDB entries)

8. Domain d4i8xg1: 4i8x G:1-159 [223028]
   Other proteins in same PDB: d4i8xa2, d4i8xb2, d4i8xc2, d4i8xd2, d4i8xe2, d4i8xf2, d4i8xg2, d4i8xh2
   automated match to d9ldta1
   complexed with 6p3

Details for d4i8xg1

PDB Entry: 4i8x, 2.23 Å

PDB Description: Crystal structure of rabbit LDHA in complex with AP27460

PDB Compounds: (G:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4i8xg1:

Sequence, based on SEQRES records:

>d4i8xg1 c.2.1.5 (G:1-159) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkysphckllvvsnpvdiltyvawkisgfpknrvig

Sequence, based on observed residues (ATOM records):

>d4i8xg1 c.2.1.5 (G:1-159) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
mmdlqhgslflrtpkivsgkdysvtansklviitagarqesrlnlvqrnvnifkfiipnv
vkysphckllvvsnpvdiltyvawkisgfpknrvig

Timeline for d4i8xg1:

• d4i8xg1 first appeared in SCOPe 2.03
  
• d4i8xg1 appears in SCOPe 2.05
  
• d4i8xg1 appears in the current release, SCOPe 2.08