Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
Protein automated matches [226882] (7 species) not a true protein |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225719] (8 PDB entries) |
Domain d4i8xf2: 4i8x F:160-331 [223027] Other proteins in same PDB: d4i8xa1, d4i8xb1, d4i8xc1, d4i8xd1, d4i8xe1, d4i8xf1, d4i8xg1, d4i8xh1 automated match to d9ldta2 complexed with 6p3 |
PDB Entry: 4i8x (more details), 2.23 Å
SCOPe Domain Sequences for d4i8xf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i8xf2 d.162.1.1 (F:160-331) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} sgcnldsarfrylmgerlgvhalschgwilgehgdssvpvwsgmnvagvslktlhpelgt dadkeqwkqvhkqvvdsayeviklkgyttwaiglsvadlaesimknlrrvhpistmlkgl ygikedvflsvpcvlgqngisdvvkvtltseeeahlkksadtlwgiqkelqf
Timeline for d4i8xf2: