Lineage for d1ej8a_ (1ej8 A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) 
Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins) 
Protein Copper chaperone for superoxide dismutase, C-terminal domain [49341] (2 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49342] (2 PDB entries) 
Domain d1ej8a_: 1ej8 A: [22300]
Details for d1ej8a_
PDB Entry: 1ej8 (more details), 1.55 Å
PDB Description: crystal structure of domain 2 of the yeast copper chaperone for superoxide dismutase (lys7) at 1.55 a resolution
SCOP Domain Sequences for d1ej8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ej8a_ b.1.8.1 (A:) Copper chaperone for superoxide dismutase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
ssavailetfqkytidqkkdtavrglarivqvgenktlfditvngvpeagnyhasihekg
dvskgvestgkvwhkfdepiecfnesdlgknlysgktflsaplptwqligrsfvisksln
hpenepssvkdysflgviar
SCOP Domain Coordinates for d1ej8a_:
Click to download the PDB-style file with coordinates for d1ej8a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ej8a_:
- d1ej8a_ appears in SCOP 1.57
- d1ej8a_ appears in the current release, SCOPe 2.08
View in 3D