Lineage for d4i55e_ (4i55 E:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1283461Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 1283620Superfamily a.137.10: Stathmin [101494] (1 family) (S)
    single long helix crosslinking four tubulin subunits
    automatically mapped to Pfam PF00836
  5. 1283621Family a.137.10.1: Stathmin [101495] (1 protein)
  6. 1283622Protein Stathmin 4 [101496] (1 species)
  7. 1283623Species Norway rat (Rattus norvegicus) [TaxId:10116] [101497] (21 PDB entries)
  8. 1283627Domain d4i55e_: 4i55 E: [222929]
    Other proteins in same PDB: d4i55a1, d4i55a2, d4i55b1, d4i55b2, d4i55c1, d4i55c2, d4i55d1, d4i55d2
    automated match to d4ihje_
    complexed with acp, ca, cl, gdp, gtp, mes, mg

Details for d4i55e_

PDB Entry: 4i55 (more details), 2.2 Å

PDB Description: crystal structure of tubulin-stathmin-ttl complex
PDB Compounds: (E:) Stathmin-4

SCOPe Domain Sequences for d4i55e_:

Sequence, based on SEQRES records: (download)

>d4i55e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsfdgvpefnaslprrrdpsleeiqkkleaaeerrkyqe
aellkhlaekrehereviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqe
kdkhaeevrknkelkeeas

Sequence, based on observed residues (ATOM records): (download)

>d4i55e_ a.137.10.1 (E:) Stathmin 4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mevielnkctsgqsfevilkppsdpsleeiqkkleaaeerrkyqeaellkhlaekreher
eviqkaieennnfikmakeklaqkmesnkenreahlaamlerlqekdkhaeevrknkelk
eeas

SCOPe Domain Coordinates for d4i55e_:

Click to download the PDB-style file with coordinates for d4i55e_.
(The format of our PDB-style files is described here.)

Timeline for d4i55e_: