Lineage for d4i2pa2 (4i2p A:430-552)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1606596Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1607696Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 1607697Protein automated matches [190396] (26 species)
    not a true protein
  7. 1607793Species Human immunodeficiency virus type 1 bh10 [TaxId:11678] [225195] (14 PDB entries)
  8. 1607795Domain d4i2pa2: 4i2p A:430-552 [222866]
    Other proteins in same PDB: d4i2pa1, d4i2pb_
    automated match to d1bqna1
    protein/DNA complex; protein/RNA complex; complexed with g73

Details for d4i2pa2

PDB Entry: 4i2p (more details), 2.3 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase in complex with rilpivirine (tmc278) based analogue
PDB Compounds: (A:) Gag-Pol polyprotein

SCOPe Domain Sequences for d4i2pa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i2pa2 c.55.3.0 (A:430-552) automated matches {Human immunodeficiency virus type 1 bh10 [TaxId: 11678]}
ekepivgaetfyvdgaanretklgkagyvtnkgrqkvvpltnttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdkseselvnqiieqlikkekvylawvpahkgiggneqvd
klv

SCOPe Domain Coordinates for d4i2pa2:

Click to download the PDB-style file with coordinates for d4i2pa2.
(The format of our PDB-style files is described here.)

Timeline for d4i2pa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4i2pa1
View in 3D
Domains from other chains:
(mouse over for more information)
d4i2pb_