Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (130 species) not a true protein |
Species Burkholderia vietnamiensis [TaxId:269482] [194164] (2 PDB entries) |
Domain d4i1vb1: 4i1v B:1-201 [222860] Other proteins in same PDB: d4i1va2, d4i1vb2 automated match to d4i1ub_ complexed with adp |
PDB Entry: 4i1v (more details), 2.6 Å
SCOPe Domain Sequences for d4i1vb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i1vb1 c.37.1.0 (B:1-201) automated matches {Burkholderia vietnamiensis [TaxId: 269482]} myaigltggigsgkttvadlfaargaslvdtdliahritapaglampaieqtfgpafvaa dgsldrarmralifsdedarrrleaithpliraetereardaqgpyvifvvpllvesrnw karcdrvlvvdcpvdtqiarvmqrngftreqveaiiarqatrearlaaaddvivndaatp dalavqvdalhqrylafaaak
Timeline for d4i1vb1: