Lineage for d4i1ib2 (4i1i B:156-324)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2232528Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2232529Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2233134Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2233135Protein automated matches [226850] (29 species)
    not a true protein
  7. 2233243Species Leishmania major [TaxId:347515] [226496] (2 PDB entries)
  8. 2233247Domain d4i1ib2: 4i1i B:156-324 [222856]
    Other proteins in same PDB: d4i1ia1, d4i1ia3, d4i1ib1
    automated match to d1civa2
    complexed with edo, nad, po4

Details for d4i1ib2

PDB Entry: 4i1i (more details), 1.5 Å

PDB Description: crystal structure of a putative cytosolic malate dehydrogenase from leishmania major friedlin in complex with nad
PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d4i1ib2:

Sequence, based on SEQRES records: (download)

>d4i1ib2 d.162.1.0 (B:156-324) automated matches {Leishmania major [TaxId: 347515]}
trldhnralsllarkagvpvsqvrnviiwgnhsstqvpdtdsavigttpareaikddald
ddfvqvvrgrgaeiiqlrglssamsaakaavdhvhdwihgtpegvyvsmgvysdenpygv
psglifsfpctchagewtvvsgklngdlgkqrlastiaelqeeraqagl

Sequence, based on observed residues (ATOM records): (download)

>d4i1ib2 d.162.1.0 (B:156-324) automated matches {Leishmania major [TaxId: 347515]}
trldhnralsllarkagvpvsqvrnviiwgnhsstqvpdtdsavigttpaddfvqvvrgr
gaeiiqlrglssamsaakaavdhvhdwihgtpegvyvsmgvysdenpygvpsglifsfpc
tchagewtvvsgklngdlgkqrlastiaelqeeraqagl

SCOPe Domain Coordinates for d4i1ib2:

Click to download the PDB-style file with coordinates for d4i1ib2.
(The format of our PDB-style files is described here.)

Timeline for d4i1ib2: