SCOP 1.63: Domain d1sdya_: 1sdy A:

Lineage for d1sdya_ (1sdy A:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49336] (12 PDB entries)

8. Domain d1sdya_: 1sdy A: [22285]

Details for d1sdya_

PDB Entry: 1sdy, 2.5 Å

PDB Description: structure solution and molecular dynamics refinement of the yeast cu, zn enzyme superoxide dismutase

SCOP Domain Sequences for d1sdya_:

Sequence; same for both SEQRES and ATOM records:

>d1sdya_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae)}
vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvsa
gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih
agqddlgkgdteeslktgnagprpacgvigltn

Timeline for d1sdya_:

• d1sdya_ first appeared (with stable ids) in SCOP 1.55
  
• d1sdya_ appears in SCOP 1.61
  
• d1sdya_ appears in SCOP 1.65
  
• d1sdya_ appears in the current release, SCOPe 2.08