SCOPe 2.06: Domain d1yaza_: 1yaz A:

Lineage for d1yaza_ (1yaz A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49336] (12 PDB entries)

8. Domain d1yaza_: 1yaz A: [22284]
   complexed with azi, cu, zn

Details for d1yaza_

PDB Entry: 1yaz, 1.7 Å

PDB Description: azide-bound yeast cu(ii)/zn superoxide dismutase room temperature (298k) structure

PDB Compounds: (A:) protein (cu/zn superoxide dismutase)

SCOPe Domain Sequences for d1yaza_:

Sequence; same for both SEQRES and ATOM records:

>d1yaza_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvsa
gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih
agqddlgkgdteeslktgnagprpacgvigltn

Timeline for d1yaza_:

• d1yaza_ first appeared (with stable ids) in SCOP 1.55
  
• d1yaza_ appears in SCOPe 2.05
  
• d1yaza_ appears in SCOPe 2.07
  
• d1yaza_ appears in the current release, SCOPe 2.08