SCOPe 2.04: Domain d4hzlb1: 4hzl B:1-113

Lineage for d4hzlb1 (4hzl B:1-113)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (122 PDB entries)

8. Domain d4hzlb1: 4hzl B:1-113 [222813]
   Other proteins in same PDB: d4hzlb2, d4hzll2
   automated match to d2jell1

Details for d4hzlb1

PDB Entry: 4hzl, 2.85 Å

PDB Description: Neutralizing antibody mAb#8 in complex with the Epitope II of HCV E2 envelope protein

PDB Compounds: (B:) Fab light chain

SCOPe Domain Sequences for d4hzlb1:

Sequence; same for both SEQRES and ATOM records:

>d4hzlb1 b.1.1.1 (B:1-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvlmtqtplslpvslgdqasiscrssqslvhsdgntylewylqkpgqspnlliyklsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpptfgggtkleikr

Timeline for d4hzlb1:

• d4hzlb1 first appeared in SCOPe 2.03
  
• d4hzlb1 appears in SCOPe 2.05
  
• d4hzlb1 appears in the current release, SCOPe 2.08