Lineage for d4hymb1 (4hym B:8-215)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1667394Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 1667395Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 1667910Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 1667911Protein automated matches [226867] (11 species)
    not a true protein
  7. 1667937Species Francisella tularensis [TaxId:376619] [226591] (4 PDB entries)
  8. 1667939Domain d4hymb1: 4hym B:8-215 [222797]
    Other proteins in same PDB: d4hyma2
    automated match to d1s16a2
    complexed with cjc

Details for d4hymb1

PDB Entry: 4hym (more details), 1.9 Å

PDB Description: Pyrrolopyrimidine inhibitors of dna gyrase b and topoisomerase iv, part i: structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic activity.
PDB Compounds: (B:) Topoisomerase IV, subunit B

SCOPe Domain Sequences for d4hymb1:

Sequence, based on SEQRES records: (download)

>d4hymb1 d.122.1.0 (B:8-215) automated matches {Francisella tularensis [TaxId: 376619]}
sievltgldpvkkrpgmytnienpnhliqeiidnsvdevlagfaskinitlyednsieva
ddgrgmpvdihpehkmsgielimtklhsggkfsnknythsgglhgvgvsvvnalstrlea
eikrdgnvyhivfedgfktkdleiidnvgkkntgtkirfwpnkkyfddikvnfkalknll
eakailckaltikysneikkekltwhfe

Sequence, based on observed residues (ATOM records): (download)

>d4hymb1 d.122.1.0 (B:8-215) automated matches {Francisella tularensis [TaxId: 376619]}
sievltgldpvkkrpgmytnienpnhliqeiidnsvdevlagfaskinitlyednsieva
ddgrgmpvdihpehkmsgielimtklhsggkfsvgvsvvnalstrleaeikrdgnvyhiv
fedgfktkdleiidnvgkkntgtkirfwpnkkyfddikvnfkalknlleakailckalti
kysneikkekltwhfe

SCOPe Domain Coordinates for d4hymb1:

Click to download the PDB-style file with coordinates for d4hymb1.
(The format of our PDB-style files is described here.)

Timeline for d4hymb1: