SCOPe 2.06: Domain d4hyma2: 4hym A:216-377

Lineage for d4hyma2 (4hym A:216-377)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.0: automated matches [191504] (1 protein)
   not a true family

6. Protein automated matches [190826] (17 species)
   not a true protein

7. Species Francisella tularensis [TaxId:376619] [226592] (4 PDB entries)

8. Domain d4hyma2: 4hym A:216-377 [222796]
   Other proteins in same PDB: d4hyma1, d4hymb1
   automated match to d1s16a1
   complexed with cjc

Details for d4hyma2

PDB Entry: 4hym, 1.9 Å

PDB Description: Pyrrolopyrimidine inhibitors of dna gyrase b and topoisomerase iv, part i: structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic activity.

PDB Compounds: (A:) Topoisomerase IV, subunit B

SCOPe Domain Sequences for d4hyma2:

Sequence, based on SEQRES records:

>d4hyma2 d.14.1.0 (A:216-377) automated matches {Francisella tularensis [TaxId: 376619]}
tglkgyldhkleaetlpaepfiidnfsngdsyldavfcwcedpsesiknsyvnliptpqd
gthvtglkngiydaikayieknslsvknikitandsfaqlnyvisvkitnpqfagqtkek
lsnkdvtnfvatavkdlltiwlnqnpdearqiveniskvaqk

Sequence, based on observed residues (ATOM records):

>d4hyma2 d.14.1.0 (A:216-377) automated matches {Francisella tularensis [TaxId: 376619]}
tglkgyldhkleaetlpaepfiidnfsngdsyldavfcwcedpsesiknsyvnliptpqd
gthvtglkngiydaikayieknsnikitandsfaqlnyvisvkitnpqfagqtkeklsnk
dvtnfvatavkdlltiwlnqnpdearqiveniskvaqk

Timeline for d4hyma2:

• d4hyma2 first appeared in SCOPe 2.03
  
• d4hyma2 appears in SCOPe 2.05
  
• d4hyma2 appears in SCOPe 2.07
  
• d4hyma2 appears in the current release, SCOPe 2.08