Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) |
Family d.122.1.0: automated matches [227160] (1 protein) not a true family |
Protein automated matches [226867] (11 species) not a true protein |
Species Francisella tularensis [TaxId:376619] [226591] (4 PDB entries) |
Domain d4hy1b1: 4hy1 B:8-215 [222789] Other proteins in same PDB: d4hy1a2 automated match to d1s16a2 complexed with 19x |
PDB Entry: 4hy1 (more details), 1.9 Å
SCOPe Domain Sequences for d4hy1b1:
Sequence, based on SEQRES records: (download)
>d4hy1b1 d.122.1.0 (B:8-215) automated matches {Francisella tularensis [TaxId: 376619]} sievltgldpvkkrpgmytnienpnhliqeiidnsvdevlagfaskinitlyednsieva ddgrgmpvdihpehkmsgielimtklhsggkfsnknythsgglhgvgvsvvnalstrlea eikrdgnvyhivfedgfktkdleiidnvgkkntgtkirfwpnkkyfddikvnfkalknll eakailckaltikysneikkekltwhfe
>d4hy1b1 d.122.1.0 (B:8-215) automated matches {Francisella tularensis [TaxId: 376619]} sievltgldpvkkrpgmytnienpnhliqeiidnsvdevlagfaskinitlyednsieva ddgrgmpvdihpehkmsgielimtklhsggkfsvgvsvvnalstrleaeikrdgnvyhiv fedgfktkdleiidnvgkkntgtkirfwpnkkyfddikvnfkalknlleakailckalti kysneikkekltwhfe
Timeline for d4hy1b1: