Lineage for d4hxzb1 (4hxz B:7-215)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212981Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2212982Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2213592Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2213593Protein automated matches [226867] (14 species)
    not a true protein
  7. 2213631Species Francisella tularensis [TaxId:376619] [226591] (4 PDB entries)
  8. 2213637Domain d4hxzb1: 4hxz B:7-215 [222786]
    Other proteins in same PDB: d4hxza2, d4hxza3
    automated match to d1s16a2
    complexed with 19y

Details for d4hxzb1

PDB Entry: 4hxz (more details), 2.7 Å

PDB Description: pyrrolopyrimidine inhibitors of dna gyrase b and topoisomerase iv, part i: structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic activity.
PDB Compounds: (B:) Topoisomerase IV, subunit B

SCOPe Domain Sequences for d4hxzb1:

Sequence, based on SEQRES records: (download)

>d4hxzb1 d.122.1.0 (B:7-215) automated matches {Francisella tularensis [TaxId: 376619]}
ksievltgldpvkkrpgmytnienpnhliqeiidnsvdevlagfaskinitlyednsiev
addgrgmpvdihpehkmsgielimtklhsggkfsnknythsgglhgvgvsvvnalstrle
aeikrdgnvyhivfedgfktkdleiidnvgkkntgtkirfwpnkkyfddikvnfkalknl
leakailckaltikysneikkekltwhfe

Sequence, based on observed residues (ATOM records): (download)

>d4hxzb1 d.122.1.0 (B:7-215) automated matches {Francisella tularensis [TaxId: 376619]}
ksievltgldpvkkrpgmytnienpnhliqeiidnsvdevlagfaskinitlyednsiev
addgrgmpvdihpehkmsgielimtklhsggkfsnhgvgvsvvnalstrleaeikrdgnv
yhivfedgfktkdleiidnvgkkntgtkirfwpnkkyfddikvnfkalknlleakailck
altikysneikkekltwhfe

SCOPe Domain Coordinates for d4hxzb1:

Click to download the PDB-style file with coordinates for d4hxzb1.
(The format of our PDB-style files is described here.)

Timeline for d4hxzb1: