Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) |
Family d.122.1.0: automated matches [227160] (1 protein) not a true family |
Protein automated matches [226867] (14 species) not a true protein |
Species Francisella tularensis [TaxId:376619] [226591] (4 PDB entries) |
Domain d4hxzb1: 4hxz B:7-215 [222786] Other proteins in same PDB: d4hxza2, d4hxza3 automated match to d1s16a2 complexed with 19y |
PDB Entry: 4hxz (more details), 2.7 Å
SCOPe Domain Sequences for d4hxzb1:
Sequence, based on SEQRES records: (download)
>d4hxzb1 d.122.1.0 (B:7-215) automated matches {Francisella tularensis [TaxId: 376619]} ksievltgldpvkkrpgmytnienpnhliqeiidnsvdevlagfaskinitlyednsiev addgrgmpvdihpehkmsgielimtklhsggkfsnknythsgglhgvgvsvvnalstrle aeikrdgnvyhivfedgfktkdleiidnvgkkntgtkirfwpnkkyfddikvnfkalknl leakailckaltikysneikkekltwhfe
>d4hxzb1 d.122.1.0 (B:7-215) automated matches {Francisella tularensis [TaxId: 376619]} ksievltgldpvkkrpgmytnienpnhliqeiidnsvdevlagfaskinitlyednsiev addgrgmpvdihpehkmsgielimtklhsggkfsnhgvgvsvvnalstrleaeikrdgnv yhivfedgfktkdleiidnvgkkntgtkirfwpnkkyfddikvnfkalknlleakailck altikysneikkekltwhfe
Timeline for d4hxzb1: