SCOPe 2.06: Domain d4hxza2: 4hxz A:216-382

Lineage for d4hxza2 (4hxz A:216-382)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.0: automated matches [191504] (1 protein)
   not a true family

6. Protein automated matches [190826] (17 species)
   not a true protein

7. Species Francisella tularensis [TaxId:376619] [226592] (4 PDB entries)

8. Domain d4hxza2: 4hxz A:216-382 [222785]
   Other proteins in same PDB: d4hxza1, d4hxza3, d4hxzb1
   automated match to d1s16a1
   complexed with 19y

Details for d4hxza2

PDB Entry: 4hxz, 2.7 Å

PDB Description: pyrrolopyrimidine inhibitors of dna gyrase b and topoisomerase iv, part i: structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic activity.

PDB Compounds: (A:) Topoisomerase IV, subunit B

SCOPe Domain Sequences for d4hxza2:

Sequence; same for both SEQRES and ATOM records:

>d4hxza2 d.14.1.0 (A:216-382) automated matches {Francisella tularensis [TaxId: 376619]}
tglkgyldhkleaetlpaepfiidnfsngdsyldavfcwcedpsesiknsyvnliptpqd
gthvtglkngiydaikayieknslsvknikitandsfaqlnyvisvkitnpqfagqtkek
lsnkdvtnfvatavkdlltiwlnqnpdearqiveniskvaqkrinad

Timeline for d4hxza2:

• d4hxza2 first appeared in SCOPe 2.03
  
• d4hxza2 appears in SCOPe 2.05
  
• d4hxza2 appears in SCOPe 2.07
  
• d4hxza2 appears in the current release, SCOPe 2.08