Lineage for d4hxza2 (4hxz A:216-383)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1636635Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 1636636Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 1637334Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 1637335Protein automated matches [190826] (16 species)
    not a true protein
  7. 1637385Species Francisella tularensis [TaxId:376619] [226592] (4 PDB entries)
  8. 1637388Domain d4hxza2: 4hxz A:216-383 [222785]
    Other proteins in same PDB: d4hxza1, d4hxzb1
    automated match to d1s16a1
    complexed with 19y

Details for d4hxza2

PDB Entry: 4hxz (more details), 2.7 Å

PDB Description: pyrrolopyrimidine inhibitors of dna gyrase b and topoisomerase iv, part i: structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic activity.
PDB Compounds: (A:) Topoisomerase IV, subunit B

SCOPe Domain Sequences for d4hxza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hxza2 d.14.1.0 (A:216-383) automated matches {Francisella tularensis [TaxId: 376619]}
tglkgyldhkleaetlpaepfiidnfsngdsyldavfcwcedpsesiknsyvnliptpqd
gthvtglkngiydaikayieknslsvknikitandsfaqlnyvisvkitnpqfagqtkek
lsnkdvtnfvatavkdlltiwlnqnpdearqiveniskvaqkrinadl

SCOPe Domain Coordinates for d4hxza2:

Click to download the PDB-style file with coordinates for d4hxza2.
(The format of our PDB-style files is described here.)

Timeline for d4hxza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hxza1
View in 3D
Domains from other chains:
(mouse over for more information)
d4hxzb1