SCOPe 2.03: Domain d4hxza1: 4hxz A:8-215

Lineage for d4hxza1 (4hxz A:8-215)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.0: automated matches [227160] (1 protein)
   not a true family

6. Protein automated matches [226867] (10 species)
   not a true protein

7. Species Francisella tularensis [TaxId:376619] [226591] (4 PDB entries)

8. Domain d4hxza1: 4hxz A:8-215 [222784]
   Other proteins in same PDB: d4hxza2
   automated match to d1s16a2
   complexed with 19y

Details for d4hxza1

PDB Entry: 4hxz, 2.7 Å

PDB Description: pyrrolopyrimidine inhibitors of dna gyrase b and topoisomerase iv, part i: structure guided discovery and optimization of dual targeting agents with potent, broad-spectrum enzymatic activity.

PDB Compounds: (A:) Topoisomerase IV, subunit B

SCOPe Domain Sequences for d4hxza1:

Sequence, based on SEQRES records:

>d4hxza1 d.122.1.0 (A:8-215) automated matches {Francisella tularensis [TaxId: 376619]}
sievltgldpvkkrpgmytnienpnhliqeiidnsvdevlagfaskinitlyednsieva
ddgrgmpvdihpehkmsgielimtklhsggkfsnknythsgglhgvgvsvvnalstrlea
eikrdgnvyhivfedgfktkdleiidnvgkkntgtkirfwpnkkyfddikvnfkalknll
eakailckaltikysneikkekltwhfe

Sequence, based on observed residues (ATOM records):

>d4hxza1 d.122.1.0 (A:8-215) automated matches {Francisella tularensis [TaxId: 376619]}
sievltgldpvkkrpgmytnienpnhliqeiidnsvdevlagfaskinitlyednsieva
ddgrgmpvdihpehkmsgielimtklhsggkfshgvgvsvvnalstrleaeikrdgnvyh
ivfedgfktkdleiidnvgkkntgtkirfwpnkkyfddikvnfkalknlleakailckal
tikysneikkekltwhfe

Timeline for d4hxza1:

• d4hxza1 is new in SCOPe 2.03-stable
  
• d4hxza1 appears in SCOPe 2.04
  
• d4hxza1 appears in the current release, SCOPe 2.08