Class a: All alpha proteins [46456] (289 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.2: Bromodomain [47370] (2 families) |
Family a.29.2.0: automated matches [191428] (1 protein) not a true family |
Protein automated matches [190615] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries) |
Domain d4hxsa1: 4hxs A:44-166 [222782] Other proteins in same PDB: d4hxsa2 automated match to d3uvya_ complexed with 1a3 |
PDB Entry: 4hxs (more details), 1.43 Å
SCOPe Domain Sequences for d4hxsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hxsa1 a.29.2.0 (A:44-166) automated matches {Human (Homo sapiens) [TaxId: 9606]} nppppetsnpnkpkrqtnqlqyllrvvlktlwkhqfawpfqqpvdavklnlpdyykiikt pmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqkine lpt
Timeline for d4hxsa1: