Lineage for d4hxbl1 (4hxb L:1-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744633Domain d4hxbl1: 4hxb L:1-107 [222771]
    Other proteins in same PDB: d4hxbl2
    automated match to d1blna1
    complexed with ca

Details for d4hxbl1

PDB Entry: 4hxb (more details), 2.45 Å

PDB Description: Crystal structure of 6B9 FAB
PDB Compounds: (L:) 6b9 fab light chain

SCOPe Domain Sequences for d4hxbl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hxbl1 b.1.1.1 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvlmtqtplslpvslgdqasiscrssqtivhsngntylewylqkpgqspklliykvsnrf
pgvpdrfsgsgsgtdftlkirrveaedlgvyycfqashdpptfgggtkleik

SCOPe Domain Coordinates for d4hxbl1:

Click to download the PDB-style file with coordinates for d4hxbl1.
(The format of our PDB-style files is described here.)

Timeline for d4hxbl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hxbl2
View in 3D
Domains from other chains:
(mouse over for more information)
d4hxbh_