SCOPe 2.05: Domain d4hwel1: 4hwe L:1-104

Lineage for d4hwel1 (4hwe L:1-104)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (120 PDB entries)

8. Domain d4hwel1: 4hwe L:1-104 [222765]
   Other proteins in same PDB: d4hwel2
   automated match to d1rhha1
   complexed with gol, so4

Details for d4hwel1

PDB Entry: 4hwe, 2.43 Å

PDB Description: Crystal structure of ectodomain 3 of the IL-13 receptor alpha1 in complex with a human neutralizing monoclonal antibody fragment

PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d4hwel1:

Sequence; same for both SEQRES and ATOM records:

>d4hwel1 b.1.1.1 (L:1-104) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evvltqspgtlslspgeratlscrasqsisssylawyqqkpgqaprlliygassratgip
drfsgsgsgtdftltisrlepedfavyycqqyetfgqgtkveik

Timeline for d4hwel1:

• d4hwel1 first appeared in SCOPe 2.03
  
• d4hwel1 appears in SCOPe 2.04
  
• d4hwel1 appears in SCOPe 2.06
  
• d4hwel1 appears in the current release, SCOPe 2.08