Lineage for d4htga1 (4htg A:10-231)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916222Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [226598] (7 PDB entries)
  8. 2916223Domain d4htga1: 4htg A:10-231 [222740]
    Other proteins in same PDB: d4htga2
    automated match to d1pdaa1
    complexed with 18w, act

Details for d4htga1

PDB Entry: 4htg (more details), 1.45 Å

PDB Description: Porphobilinogen Deaminase from Arabidopsis Thaliana
PDB Compounds: (A:) Porphobilinogen deaminase, chloroplastic

SCOPe Domain Sequences for d4htga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4htga1 c.94.1.0 (A:10-231) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
taiirigtrgsplalaqayetreklkkkhpelvedgaihieiikttgdkilsqpladigg
kglftkeidealinghidiavhsmkdvptylpektilpcnlpredvrdaficltaatlae
lpagsvvgtaslrrksqilhkypalhveenfrgnvqtrlsklqggkvqatllalaglkrl
smtenvasilsldemlpavaqgaigiacrtdddkmatylasl

SCOPe Domain Coordinates for d4htga1:

Click to download the PDB-style file with coordinates for d4htga1.
(The format of our PDB-style files is described here.)

Timeline for d4htga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4htga2