SCOPe 2.06: Domain d4ht1l2: 4ht1 L:112-217

Lineage for d4ht1l2 (4ht1 L:112-217)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [226687] (4 PDB entries)

8. Domain d4ht1l2: 4ht1 L:112-217 [222739]
   Other proteins in same PDB: d4ht1l1
   automated match to d1rhha2

Details for d4ht1l2

PDB Entry: 4ht1, 2.5 Å

PDB Description: human tweak in complex with the fab fragment of a neutralizing antibody

PDB Compounds: (L:) chimeric antibody Fab

SCOPe Domain Sequences for d4ht1l2:

Sequence; same for both SEQRES and ATOM records:

>d4ht1l2 b.1.1.2 (L:112-217) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d4ht1l2:

• d4ht1l2 first appeared in SCOPe 2.03
  
• d4ht1l2 appears in SCOPe 2.05
  
• d4ht1l2 appears in SCOPe 2.07
  
• d4ht1l2 appears in the current release, SCOPe 2.08