Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Dehaloperoxidase [46530] (1 species) |
Species Amphitrite ornata [TaxId:129555] [46531] (32 PDB entries) |
Domain d4hswa_: 4hsw A: [222736] automated match to d4hsxb_ complexed with gol, hem, so4; mutant |
PDB Entry: 4hsw (more details), 1.22 Å
SCOPe Domain Sequences for d4hswa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hswa_ a.1.1.2 (A:) Dehaloperoxidase {Amphitrite ornata [TaxId: 129555]} gfkqdiatirgdlrtyaqdiflaflnkypderryfknyvgksdqelksmakfgdhtekvf nlmmevadratdcvplasdantlvqmkqhsslttgnfekffvalveymrasgqsfdsqsw drfgknlvsalssagmk
Timeline for d4hswa_: