SCOPe 2.08: Domain d4hs1a1: 4hs1 A:2-79

Lineage for d4hs1a1 (4hs1 A:2-79)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein automated matches [190442] (13 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [226696] (2 PDB entries)

8. Domain d4hs1a1: 4hs1 A:2-79 [222732]
   Other proteins in same PDB: d4hs1a2
   automated match to d1r7ha_
   complexed with cl, gol, no3, peg

Details for d4hs1a1

PDB Entry: 4hs1, 0.87 Å

PDB Description: High-resolution crystal structure of Glutaredoxin like protein NrdH from Mycobacterium tuberculosis.

PDB Compounds: (A:) Glutaredoxin NrdH, putative

SCOPe Domain Sequences for d4hs1a1:

Sequence; same for both SEQRES and ATOM records:

>d4hs1a1 c.47.1.1 (A:2-79) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
tvtvytkpacvqcsatskaldkqgiayqkvdisldseardyvmalgylqapvvvagndhw
sgfrpdrikalagaalta

Timeline for d4hs1a1:

• d4hs1a1 first appeared in SCOPe 2.03, called d4hs1a_
  
• d4hs1a1 appears in SCOPe 2.07