Lineage for d1ba9__ (1ba9 -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 10106Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
  5. 10107Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 10118Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)
  7. 10172Species Human (Homo sapiens) [TaxId:9606] [49333] (7 PDB entries)
  8. 10199Domain d1ba9__: 1ba9 - [22272]

Details for d1ba9__

PDB Entry: 1ba9 (more details)

PDB Description: the solution structure of reduced monomeric superoxide dismutase, nmr, 36 structures

SCOP Domain Sequences for d1ba9__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ba9__ b.1.8.1 (-) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens)}
atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvheeedntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
ekaddlgkggneqstktgnagsrlacgvigiaq

SCOP Domain Coordinates for d1ba9__:

Click to download the PDB-style file with coordinates for d1ba9__.
(The format of our PDB-style files is described here.)

Timeline for d1ba9__: