Class a: All alpha proteins [46456] (289 folds) |
Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
Protein automated matches [226935] (26 species) not a true protein |
Species Mycobacterium abscessus [TaxId:561007] [226109] (2 PDB entries) |
Domain d4hr3a2: 4hr3 A:254-409 [222717] Other proteins in same PDB: d4hr3a1 automated match to d1egda1 complexed with fad |
PDB Entry: 4hr3 (more details), 1.8 Å
SCOPe Domain Sequences for d4hr3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hr3a2 a.29.3.0 (A:254-409) automated matches {Mycobacterium abscessus [TaxId: 561007]} gkgfeiaqgrlgpgrvhhamrliglaevalehacrrgldrtafgkplvnlggnreriada riainqtrllvlhaawlldtvgimgalsavseikvaapnmaqqvidmaiqihgggglsnd fplaaawvnaralrladgpdevhrgvvarielakya
Timeline for d4hr3a2: