Lineage for d4hr3a2 (4hr3 A:254-409)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993780Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1994829Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 1994963Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 1994964Protein automated matches [226935] (26 species)
    not a true protein
  7. 1995100Species Mycobacterium abscessus [TaxId:561007] [226109] (2 PDB entries)
  8. 1995101Domain d4hr3a2: 4hr3 A:254-409 [222717]
    Other proteins in same PDB: d4hr3a1
    automated match to d1egda1
    complexed with fad

Details for d4hr3a2

PDB Entry: 4hr3 (more details), 1.8 Å

PDB Description: structure of a putative acyl-coa dehydrogenase from mycobacterium abscessus
PDB Compounds: (A:) putative acyl-CoA dehydrogenase

SCOPe Domain Sequences for d4hr3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hr3a2 a.29.3.0 (A:254-409) automated matches {Mycobacterium abscessus [TaxId: 561007]}
gkgfeiaqgrlgpgrvhhamrliglaevalehacrrgldrtafgkplvnlggnreriada
riainqtrllvlhaawlldtvgimgalsavseikvaapnmaqqvidmaiqihgggglsnd
fplaaawvnaralrladgpdevhrgvvarielakya

SCOPe Domain Coordinates for d4hr3a2:

Click to download the PDB-style file with coordinates for d4hr3a2.
(The format of our PDB-style files is described here.)

Timeline for d4hr3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hr3a1