Lineage for d4hpsc_ (4hps C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889399Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families) (S)
  5. 2889462Family c.56.4.0: automated matches [191433] (1 protein)
    not a true family
  6. 2889463Protein automated matches [190623] (6 species)
    not a true protein
  7. 2889485Species Xenorhabdus bovienii [TaxId:406818] [193515] (2 PDB entries)
  8. 2889488Domain d4hpsc_: 4hps C: [222710]
    Other proteins in same PDB: d4hpsa2, d4hpsb2
    automated match to d3ro0b_
    complexed with cl

Details for d4hpsc_

PDB Entry: 4hps (more details), 1.55 Å

PDB Description: crystal structure of a pyrrolidone-carboxylate peptidase 1 (target id nysgrc-012831) from xenorhabdus bovienii ss-2004 in space group p21
PDB Compounds: (C:) Pyrrolidone-carboxylate peptidase

SCOPe Domain Sequences for d4hpsc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hpsc_ c.56.4.0 (C:) automated matches {Xenorhabdus bovienii [TaxId: 406818]}
ktilvtafdpfggeainpsweaikplqgsqvfganieicqipcifdtslehlyaavdkyq
pelvisvgqaggrtnitvervainindaripdnagnqpidtpvivdgpaayfsrlpiktm
vnalntagipasvsqtagtfvcnhvmygllhylaqntpsvrggfihvpylpeqavkdgnq
ssmtlmlmtlalkiaietawkntsd

SCOPe Domain Coordinates for d4hpsc_:

Click to download the PDB-style file with coordinates for d4hpsc_.
(The format of our PDB-style files is described here.)

Timeline for d4hpsc_: