SCOPe 2.08: Domain d4hp4b_: 4hp4 B:

Lineage for d4hp4b_ (4hp4 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.0: automated matches [191387] (1 protein)
   not a true family

6. Protein automated matches [190492] (24 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [226626] (6 PDB entries)

8. Domain d4hp4b_: 4hp4 B: [222706]
   automated match to d2z6da_
   complexed with gol, so4

Details for d4hp4b_

PDB Entry: 4hp4, 2 Å

PDB Description: Crystal structure of PAS domain from the fruit-fly ELK potassium channel

PDB Compounds: (B:) Eag-like K[+] channel

SCOPe Domain Sequences for d4hp4b_:

Sequence; same for both SEQRES and ATOM records:

>d4hp4b_ d.110.3.0 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
qntfldtiatrfdgthsnfvlgnaqangnpivycsdgfvdltgysraqimqkgcschfly
gpdtkeehkqqiekslsnkmelklevifykkegapfwclfdivpiknekrdvvlflashk
dithtk

Timeline for d4hp4b_:

• d4hp4b_ first appeared in SCOPe 2.03
  
• d4hp4b_ appears in SCOPe 2.07