SCOPe 2.06: Domain d4hoya_: 4hoy A:

Lineage for d4hoya_ (4hoy A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families)

5. Family c.56.3.0: automated matches [193325] (1 protein)
   not a true family

6. Protein automated matches [193326] (10 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:575584] [196867] (16 PDB entries)

8. Domain d4hoya_: 4hoy A: [222703]
   automated match to d4jy7a_
   complexed with act, edo, gol, peg

Details for d4hoya_

PDB Entry: 4hoy, 1.78 Å

PDB Description: Crystal structure of Peptidyl- tRNA Hydrolase from Acinetobacter baumannii at 1.78 A resolution

PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d4hoya_:

Sequence; same for both SEQRES and ATOM records:

>d4hoya_ c.56.3.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 575584]}
msnislivglgnpgseyaqtrhnagfwfveqladkygitlkndpkfhgisgrgnieghdv
rlllpmtymnrsgqsvvpfskfyqiapeailiahdeldmnpgvirlktggghgghnglrd
ivphigpnfhrlrigighpgskervsghvlgkapsneqslmdgaidhalskvkllvqgqv
pqamnqinaykpa

Timeline for d4hoya_:

• d4hoya_ first appeared in SCOPe 2.03
  
• d4hoya_ appears in SCOPe 2.05
  
• d4hoya_ appears in SCOPe 2.07
  
• d4hoya_ appears in the current release, SCOPe 2.08