Lineage for d4hnzj_ (4hnz J:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676433Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1676434Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1679108Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 1679109Protein automated matches [190509] (9 species)
    not a true protein
  7. 1679201Species Trypanosoma brucei [TaxId:999953] [224942] (2 PDB entries)
  8. 1679211Domain d4hnzj_: 4hnz J: [222696]
    automated match to d1g3ka_
    complexed with mg

Details for d4hnzj_

PDB Entry: 4hnz (more details), 2.39 Å

PDB Description: Crystal structure of eukaryotic HslV from Trypanosoma brucei
PDB Compounds: (J:) HslVU complex proteolytic subunit, putative

SCOPe Domain Sequences for d4hnzj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hnzj_ d.153.1.0 (J:) automated matches {Trypanosoma brucei [TaxId: 999953]}
ttilsvrkgdtvvllgdrqvtlgerivakssacklrrinddvvigfagstadaislmekl
enkigefpnqltraavelakewrtdralrrleaslivcsaeetleidgqgnvitpeadgi
vaigsggtfakaaaralidvdgydaekiarkamriatdidvfsnehwdvevleh

SCOPe Domain Coordinates for d4hnzj_:

Click to download the PDB-style file with coordinates for d4hnzj_.
(The format of our PDB-style files is described here.)

Timeline for d4hnzj_: