Lineage for d4hlzj1 (4hlz J:3-109)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1520466Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)
  8. 1521058Domain d4hlzj1: 4hlz J:3-109 [222667]
    Other proteins in same PDB: d4hlza_, d4hlzb_, d4hlzc_, d4hlzd_, d4hlze_, d4hlzf_, d4hlzh2, d4hlzj2, d4hlzl2
    automated match to d1dqdl1
    complexed with edo, nag, so4

Details for d4hlzj1

PDB Entry: 4hlz (more details), 2.9 Å

PDB Description: crystal structure of fab c179 in complex with a h2n2 influenza virus hemagglutinin
PDB Compounds: (J:) Fab C179 light chain

SCOPe Domain Sequences for d4hlzj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hlzj1 b.1.1.0 (J:3-109) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
diqmtqspasqsaslgesvtitclasqtigtwlawyqqkpgkspqlliyaatsladgvps
rfsgsgsgtkfsfkisslqaedfvsyycqqlystpwtfgggtrleik

SCOPe Domain Coordinates for d4hlzj1:

Click to download the PDB-style file with coordinates for d4hlzj1.
(The format of our PDB-style files is described here.)

Timeline for d4hlzj1: