Lineage for d4hlzh2 (4hlz H:110-213)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517994Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries)
  8. 1518461Domain d4hlzh2: 4hlz H:110-213 [222666]
    Other proteins in same PDB: d4hlza_, d4hlzb_, d4hlzc_, d4hlzd_, d4hlze_, d4hlzf_, d4hlzh1, d4hlzj1, d4hlzl1
    automated match to d1dqdl2
    complexed with edo, nag, so4

Details for d4hlzh2

PDB Entry: 4hlz (more details), 2.9 Å

PDB Description: crystal structure of fab c179 in complex with a h2n2 influenza virus hemagglutinin
PDB Compounds: (H:) Fab C179 light chain

SCOPe Domain Sequences for d4hlzh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hlzh2 b.1.1.2 (H:110-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOPe Domain Coordinates for d4hlzh2:

Click to download the PDB-style file with coordinates for d4hlzh2.
(The format of our PDB-style files is described here.)

Timeline for d4hlzh2: