Lineage for d4hlze1 (4hlz E:10-326)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2047495Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2047496Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2047543Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2047544Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2047584Species Influenza A virus, different strains [TaxId:11320] [49825] (116 PDB entries)
  8. 2047844Domain d4hlze1: 4hlz E:10-326 [222664]
    Other proteins in same PDB: d4hlza2, d4hlzb_, d4hlzc2, d4hlzd_, d4hlze2, d4hlzf_, d4hlzh1, d4hlzh2, d4hlzj1, d4hlzj2, d4hlzl1, d4hlzl2
    automated match to d3ku3a_
    complexed with edo, nag, so4

Details for d4hlze1

PDB Entry: 4hlz (more details), 2.9 Å

PDB Description: crystal structure of fab c179 in complex with a h2n2 influenza virus hemagglutinin
PDB Compounds: (E:) hemagglutinin HA1

SCOPe Domain Sequences for d4hlze1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hlze1 b.19.1.2 (E:10-326) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
gdqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsiag
wllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilpk
drwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvhh
pndeteqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvngqggrmefswtlldmwdtin
festgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhpltig
ecpkyvkseklvlatglrnvpqi

SCOPe Domain Coordinates for d4hlze1:

Click to download the PDB-style file with coordinates for d4hlze1.
(The format of our PDB-style files is described here.)

Timeline for d4hlze1: