Class b: All beta proteins [48724] (176 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein Hemagglutinin [49824] (7 species) includes rudiment esterase domain |
Species Influenza A virus, different strains [TaxId:11320] [49825] (105 PDB entries) |
Domain d4hlzc_: 4hlz C: [222663] Other proteins in same PDB: d4hlzb_, d4hlzd_, d4hlzf_, d4hlzh1, d4hlzh2, d4hlzj1, d4hlzj2, d4hlzl1, d4hlzl2 automated match to d3ku3a_ complexed with edo, nag, so4 |
PDB Entry: 4hlz (more details), 2.9 Å
SCOPe Domain Sequences for d4hlzc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hlzc_ b.19.1.2 (C:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]} pgdqicigyhannstekvdtilernvtvthakdilekthngklcklngipplelgdcsia gwllgnpecdrllsvpewsyimekenprdglcypgsfndyeelkhllssvkhfekvkilp kdrwtqhtttggsracavsgnpsffrnmvwltekgsnypvakgsynntsgeqmliiwgvh hpndeteqrtlyqnvgtyvsvgtstlnkrstpeiatrpkvngqggrmefswtlldmwdti nfestgnliapeygfkiskrgssgimktegtlencetkcqtplgainttlpfhnvhplti gecpkyvkseklvlatglrnvpqi
Timeline for d4hlzc_: