SCOP 1.61: Domain d1funh_: 1fun H:

Lineage for d1funh_ (1fun H:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family)

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49333] (8 PDB entries)

8. Domain d1funh_: 1fun H: [22266]

Details for d1funh_

PDB Entry: 1fun, 2.85 Å

PDB Description: superoxide dismutase mutant with lys 136 replaced by glu, cys 6 replaced by ala and cys 111 replaced by ser (k136e, c6a, c111s)

SCOP Domain Sequences for d1funh_:

Sequence; same for both SEQRES and ATOM records:

>d1funh_ b.1.8.1 (H:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens)}
atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
ekaddlgkggneestetgnagsrlacgvigiaq

Timeline for d1funh_:

• d1funh_ first appeared (with stable ids) in SCOP 1.55
  
• d1funh_ appears in SCOP 1.59
  
• d1funh_ appears in SCOP 1.63
  
• d1funh_ appears in the current release, SCOPe 2.08