Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (79 species) not a true protein |
Species Staphylococcus aureus [TaxId:282458] [193407] (3 PDB entries) |
Domain d4hlda_: 4hld A: [222658] automated match to d2ccka_ complexed with 16t |
PDB Entry: 4hld (more details), 2 Å
SCOPe Domain Sequences for d4hlda_:
Sequence, based on SEQRES records: (download)
>d4hlda_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 282458]} safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqrfksv nadqplenvvedtyqtiikylek
>d4hlda_ c.37.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 282458]} safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain glypdltiylnvsaevgreriikndqedlkfhekviegyqeiihnesqrfksvnadqple nvvedtyqtiikylek
Timeline for d4hlda_: