SCOPe 2.06: Domain d4hjxa_: 4hjx A:

Lineage for d4hjxa_ (4hjx A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
   contains a conserved all-alpha subdomain at the C-terminal extension

6. Protein automated matches [190581] (9 species)
   not a true protein

7. Species Methanocaldococcus jannaschii [TaxId:243232] [193079] (10 PDB entries)

8. Domain d4hjxa_: 4hjx A: [222644]
   automated match to d4hjrb_
   protein/RNA complex; complexed with f2y

Details for d4hjxa_

PDB Entry: 4hjx, 2.91 Å

PDB Description: crystal structure of f2yrs complexed with f2y

PDB Compounds: (A:) Tyrosine-tRNA ligase

SCOPe Domain Sequences for d4hjxa_:

Sequence; same for both SEQRES and ATOM records:

>d4hjxa_ c.26.1.1 (A:) automated matches {Methanocaldococcus jannaschii [TaxId: 243232]}
mdefemikrntseiiseeelrevlkkdeksarigfepsgkihlghylqikkmidlqnagf
diiiyladlgaylnqkgeldeirkigdynkkvfeamglkakyvygsencldkdytlnvyr
lalkttlkrarrsmeliaredenpkvaeviypimqvnnihysgvdvavggmeqrkihmla
rellpkkvvcihnpvltgldgegkmssskgnfiavddspeeirakikkaycpagvvegnp
imeiakyfleypltikrpekfggdltvnsyeeleslfknkelhpmdlknavaeelikile
pirkrl

Timeline for d4hjxa_:

• d4hjxa_ first appeared in SCOPe 2.03
  
• d4hjxa_ appears in SCOPe 2.05
  
• d4hjxa_ appears in SCOPe 2.07
  
• d4hjxa_ appears in the current release, SCOPe 2.08