SCOPe 2.03: Domain d4hihc1: 4hih C:2-107

Lineage for d4hihc1 (4hih C:2-107)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)

8. Domain d4hihc1: 4hih C:2-107 [222626]
   automated match to d1boga1
   complexed with ram

Details for d4hihc1

PDB Entry: 4hih, 2 Å

PDB Description: anti-streptococcus pneumoniae 23f fab 023.102 with bound rhamnose.

PDB Compounds: (C:) Fab 023.102

SCOPe Domain Sequences for d4hihc1:

Sequence, based on SEQRES records:

>d4hihc1 b.1.1.0 (C:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqltqspatlslspgeratlscrasqsvtnylawyqqkpgqaprlliygasnratgipar
fsgsgsgtdftltisslepedfavyycqqrdnwppdatfgqgtkveik

Sequence, based on observed residues (ATOM records):

>d4hihc1 b.1.1.0 (C:2-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqltqspatlslspgeratlscratnylawyqqkpgqaprlliygasnratgiparfsgs
gsgtdftltisslepedfavyycqqrdnwppdatfgqgtkveik

Timeline for d4hihc1:

• d4hihc1 is new in SCOPe 2.03-stable
  
• d4hihc1 appears in SCOPe 2.04
  
• d4hihc1 appears in the current release, SCOPe 2.08