Lineage for d4hgma_ (4hgm A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757949Protein automated matches [190119] (18 species)
    not a true protein
  7. 1758001Species Dogfish (Squalus acanthias) [TaxId:7797] [226656] (2 PDB entries)
  8. 1758002Domain d4hgma_: 4hgm A: [222571]
    Other proteins in same PDB: d4hgmb1, d4hgmb2, d4hgmb3
    automated match to d1fgvl_
    complexed with ace, edo

Details for d4hgma_

PDB Entry: 4hgm (more details), 2.34 Å

PDB Description: shark ignar variable domain
PDB Compounds: (A:) Shark V-NAR

SCOPe Domain Sequences for d4hgma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hgma_ b.1.1.1 (A:) automated matches {Dogfish (Squalus acanthias) [TaxId: 7797]}
trvdqspsslsasvgdrvtitcvltdtsyplystywyqqkpgssnkeqisisgrysesvn
kgtksftltisslqpedfatyycramgtniwtgdgagtkveik

SCOPe Domain Coordinates for d4hgma_:

Click to download the PDB-style file with coordinates for d4hgma_.
(The format of our PDB-style files is described here.)

Timeline for d4hgma_: