Lineage for d1sosi_ (1sos I:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 10106Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
  5. 10107Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 10118Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)
  7. 10172Species Human (Homo sapiens) [TaxId:9606] [49333] (7 PDB entries)
  8. 10184Domain d1sosi_: 1sos I: [22257]

Details for d1sosi_

PDB Entry: 1sos (more details), 2.5 Å

PDB Description: atomic structures of wild-type and thermostable mutant recombinant human cu, zn superoxide dismutase

SCOP Domain Sequences for d1sosi_:

Sequence, based on SEQRES records: (download)

>d1sosi_ b.1.8.1 (I:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens)}
tkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsag
phfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvhe
kaddlgkggneestktgnagsrlacgvigiaq

Sequence, based on observed residues (ATOM records): (download)

>d1sosi_ b.1.8.1 (I:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens)}
atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

SCOP Domain Coordinates for d1sosi_:

Click to download the PDB-style file with coordinates for d1sosi_.
(The format of our PDB-style files is described here.)

Timeline for d1sosi_: