Lineage for d4hf7a_ (4hf7 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857378Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 2857506Family c.23.10.0: automated matches [191588] (1 protein)
    not a true family
  6. 2857507Protein automated matches [191059] (16 species)
    not a true protein
  7. 2857522Species Bacteroides thetaiotaomicron [TaxId:226186] [226509] (1 PDB entry)
  8. 2857523Domain d4hf7a_: 4hf7 A: [222557]
    automated match to d1yzfa1

Details for d4hf7a_

PDB Entry: 4hf7 (more details), 1.77 Å

PDB Description: crystal structure of a gdsl-like lipase (bt0569) from bacteroides thetaiotaomicron vpi-5482 at 1.77 a resolution
PDB Compounds: (A:) Putative acylhydrolase

SCOPe Domain Sequences for d4hf7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hf7a_ c.23.10.0 (A:) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
efanykryatenaalaqpvkkekrvvfmgnsitegwvrthpdffktngyigrgisgqtsy
qfllrfredvinlspalvvinagtndvaentgaynedytfgniasmaelakankikvilt
svlpaaefpwrreikdapqkiqslnarieayakankipfvnyyqpmvvgenkalnpqytk
dgvhptgegydimealikqaiekal

SCOPe Domain Coordinates for d4hf7a_:

Click to download the PDB-style file with coordinates for d4hf7a_.
(The format of our PDB-style files is described here.)

Timeline for d4hf7a_: