Lineage for d4hdia1 (4hdi A:1-112)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024733Species Mouse (Mus musculus) [TaxId:10090] [186842] (156 PDB entries)
  8. 2024854Domain d4hdia1: 4hdi A:1-112 [222529]
    Other proteins in same PDB: d4hdia2, d4hdil2
    automated match to d1t66c1

Details for d4hdia1

PDB Entry: 4hdi (more details), 2.45 Å

PDB Description: Crystal Structure of 3E5 IgG3 FAB from mus musculus
PDB Compounds: (A:) Kappa light chain variable region, Anti-colorectal carcinoma light chain

SCOPe Domain Sequences for d4hdia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hdia1 b.1.1.1 (A:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvanrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpwtfgggtkleik

SCOPe Domain Coordinates for d4hdia1:

Click to download the PDB-style file with coordinates for d4hdia1.
(The format of our PDB-style files is described here.)

Timeline for d4hdia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hdia2